EGF - Protein (ID:)
| Name: | EGF |
| HMS LINCS ID: | 201357 |
| UniProt ID: | P01133 |
| Alternative Names: | Epidermal Growth Factor; Urogastrone; URG |
| Provider: | PeproTech |
| Provider Catalog ID: | AF-100-15 |
| Amino Acid Sequence: | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Gene Symbol: | |
| Gene ID: | |
| Protein Source: | E.coli |
| Mutation: | |
| Phosphlorylation State: | |
| Domain: | |
| Protein Description: | |
| Protein Purity: | greater than 98% by SDS-PAGE gel and HPLC analyses (source: PeproTech) |
| Protein Complex: | |
| Isoform: | |
| Protein Type: | |
| Source Organism: | |
| Reference: | |
| Comments: | |
| Date Publicly Available: | 2016-09-14 |
| Most Recent Update: | 2016-09-14 |
Datasets:
| HMS Dataset ID | Dataset Title | HMS Dataset Type |
|---|---|---|
| 20265 | Multiplexed imaging of protein levels and protein phosphorylation states in the MCF 10A breast cell line treated with EGF | Microscopy/Imaging |
| 20267 | Highly-multiplexed imaging by Cyclic Immunofluorescence (CycIF) of protein levels and protein phosphorylation states in the MCF 10A breast cell line treated with EGF or four kinase inhibitors | Microscopy/Imaging |