HGF - Protein (ID:)
| Name: | HGF |
| HMS LINCS ID: | 201403 |
| UniProt ID: | P14210 |
| Alternative Names: | Hepatocyte growth factor; Hepatopoietin-A; Scatter factor; SF |
| Provider: | PeproTech |
| Provider Catalog ID: | 100-39 |
| Amino Acid Sequence: | alpha chain: QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR beta chain: VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS |
| Gene Symbol: | |
| Gene ID: | |
| Protein Source: | (BTI-Tn-5B1-4) Hi-5 Insect cells |
| Mutation: | |
| Phosphlorylation State: | |
| Domain: | |
| Protein Description: | |
| Protein Purity: | greater than 98% by SDS-PAGE gel and HPLC analyses (source: PeproTech) |
| Protein Complex: | |
| Isoform: | |
| Protein Type: | |
| Source Organism: | |
| Reference: | |
| Comments: | |
| Date Publicly Available: | 2017-05-02 |
| Most Recent Update: | 2017-05-02 |
Datasets:
| HMS Dataset ID | Dataset Title | HMS Dataset Type |
|---|---|---|
| 20287 | FoxO3a nuclear-cytoplasmic pulsing dynamics in a mammary epithelial cell line following growth-factor treatment with varying ERK/AKT activation loads. Dataset 1 of 3: single-cell reporter measurements. | Microscopy/Imaging |
| 20288 | FoxO3a nuclear-cytoplasmic pulsing dynamics in a mammary epithelial cell line following growth-factor treatment with varying ERK/AKT activation loads. Dataset 2 of 3: single-cell reporter pulsing metrics. | Analysis |
| 20289 | FoxO3a nuclear-cytoplasmic pulsing dynamics in a mammary epithelial cell line following growth-factor treatment with varying ERK/AKT activation loads. Dataset 3 of 3: mean reporter pulsing metrics. | Analysis |
| 20290 | Growth factor-induced FoxO3a nuclear-cytoplasmic pulsing dynamics of non-phosphorylatable reporters in mammary epithelial cell lines. Dataset 1 of 3: single-cell reporter measurements. | Microscopy/Imaging |
| 20291 | Growth factor-induced FoxO3a nuclear-cytoplasmic pulsing dynamics of non-phosphorylatable reporters in mammary epithelial cell lines. Dataset 2 of 3: single-cell reporter pulsing metrics. | Analysis |
| 20292 | Growth factor-induced FoxO3a nuclear-cytoplasmic pulsing dynamics of non-phosphorylatable reporters in mammary epithelial cell lines. Dataset 3 of 3: mean reporter pulsing metrics. | Analysis |
| 20299 | Growth factor-induced ERK activity and FoxO3a nuclear-cytoplasmic pulsing dynamics in a mammary epithelial cell line. Dataset 1 of 1: single-cell reporter measurements. | Microscopy/Imaging |
| 20300 | Growth factor-induced ERK activity pulsing dynamics in a mammary epithelial cell line. Dataset 1 of 3: single-cell reporter measurements. | Microscopy/Imaging |
| 20301 | Growth factor-induced ERK activity pulsing dynamics in a mammary epithelial cell line. Dataset 2 of 3: single-cell reporter pulsing metrics. | Analysis |
| 20302 | Growth factor-induced ERK activity pulsing dynamics in a mammary epithelial cell line. Dataset 3 of 3: mean reporter pulsing metrics. | Analysis |