NRG1 - Protein (ID:)
Name: | NRG1 |
HMS LINCS ID: | 201402 |
UniProt ID: | Q02297 |
Alternative Names: | Pro-neuregulin-1; Pro-NRG1; Neuregulin-1; Acetylcholine receptor-inducing activity; ARIA; Breast cancer cell differentiation factor p45; Glial growth factor; Heregulin; HRG; Neu differentiation factor; Sensory and motor neuron-derived factor |
Provider: | PeproTech |
Provider Catalog ID: | AF-100-03 |
Amino Acid Sequence: | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE |
Gene Symbol: | |
Gene ID: | |
Protein Source: | E.coli |
Mutation: | |
Phosphlorylation State: | |
Domain: | |
Protein Description: | |
Protein Purity: | greater than 98% by SDS-PAGE gel and HPLC analyses (source: PeproTech) |
Protein Complex: | |
Isoform: | |
Protein Type: | |
Source Organism: | |
Reference: | |
Comments: | |
Date Publicly Available: | 2017-05-02 |
Most Recent Update: | 2017-05-02 |
Datasets:
HMS Dataset ID | Dataset Title | HMS Dataset Type |
---|---|---|
20287 | FoxO3a nuclear-cytoplasmic pulsing dynamics in a mammary epithelial cell line following growth-factor treatment with varying ERK/AKT activation loads. Dataset 1 of 3: single-cell reporter measurements. | Microscopy/Imaging |
20288 | FoxO3a nuclear-cytoplasmic pulsing dynamics in a mammary epithelial cell line following growth-factor treatment with varying ERK/AKT activation loads. Dataset 2 of 3: single-cell reporter pulsing metrics. | Analysis |
20289 | FoxO3a nuclear-cytoplasmic pulsing dynamics in a mammary epithelial cell line following growth-factor treatment with varying ERK/AKT activation loads. Dataset 3 of 3: mean reporter pulsing metrics. | Analysis |
20290 | Growth factor-induced FoxO3a nuclear-cytoplasmic pulsing dynamics of non-phosphorylatable reporters in mammary epithelial cell lines. Dataset 1 of 3: single-cell reporter measurements. | Microscopy/Imaging |
20291 | Growth factor-induced FoxO3a nuclear-cytoplasmic pulsing dynamics of non-phosphorylatable reporters in mammary epithelial cell lines. Dataset 2 of 3: single-cell reporter pulsing metrics. | Analysis |
20292 | Growth factor-induced FoxO3a nuclear-cytoplasmic pulsing dynamics of non-phosphorylatable reporters in mammary epithelial cell lines. Dataset 3 of 3: mean reporter pulsing metrics. | Analysis |
20299 | Growth factor-induced ERK activity and FoxO3a nuclear-cytoplasmic pulsing dynamics in a mammary epithelial cell line. Dataset 1 of 1: single-cell reporter measurements. | Microscopy/Imaging |
20300 | Growth factor-induced ERK activity pulsing dynamics in a mammary epithelial cell line. Dataset 1 of 3: single-cell reporter measurements. | Microscopy/Imaging |
20301 | Growth factor-induced ERK activity pulsing dynamics in a mammary epithelial cell line. Dataset 2 of 3: single-cell reporter pulsing metrics. | Analysis |
20302 | Growth factor-induced ERK activity pulsing dynamics in a mammary epithelial cell line. Dataset 3 of 3: mean reporter pulsing metrics. | Analysis |