Leptin - Protein (ID:)
| Name: | Leptin |
| HMS LINCS ID: | 201292 |
| UniProt ID: | P41159 |
| Alternative Names: | Obese protein (OB); Obesity factor |
| Provider: | PeproTech |
| Provider Catalog ID: | 300-27 |
| Amino Acid Sequence: | MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Gene Symbol: | LEP |
| Gene ID: | |
| Protein Source: | recombinantly expressed in E. coli |
| Mutation: | |
| Phosphlorylation State: | |
| Domain: | |
| Protein Description: | |
| Protein Purity: | >98% by SDS-PAGE gel and HPLC analyses |
| Protein Complex: | |
| Isoform: | |
| Protein Type: | cytokine |
| Source Organism: | Homo sapiens |
| Reference: | |
| Comments: | |
| Date Publicly Available: | |
| Most Recent Update: | 2016-09-14 |
Datasets:
| HMS Dataset ID | Dataset Title | HMS Dataset Type |
|---|---|---|
| 20233 | Synovial Fibroblast 1: Secretion response of primary human synovial fibroblast samples from one healthy and one rheumatoid arthritis donor to a panel of 10 stimuli and 10 small molecule inhibitors | Bead-based immunoassay |