EFNA1 - Protein (ID:)
| Name: | EFNA1 |
| HMS LINCS ID: | 200863 |
| UniProt ID: | P20827 |
| Alternative Names: | Ephrin-A1 |
| Provider: | R&D Systems |
| Provider Catalog ID: | 6417-A1 |
| Amino Acid Sequence: | DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS |
| Gene Symbol: | EFNA1 |
| Gene ID: | |
| Protein Source: | recombinantly expressed in a mouse myeloma cell line, NS0-derived |
| Mutation: | |
| Phosphlorylation State: | |
| Domain: | |
| Protein Description: | |
| Protein Purity: | > 95%, by SDSPAGE under reducing conditions and visualized by silver stain |
| Protein Complex: | Disulfide-linked homodimer |
| Isoform: | |
| Protein Type: | ligand |
| Source Organism: | Homo sapiens |
| Reference: | |
| Comments: | |
| Date Publicly Available: | |
| Most Recent Update: | 2016-09-14 |
Datasets:
| HMS Dataset ID | Dataset Title | HMS Dataset Type |
|---|---|---|
| 20138 | Cell signaling response to growth factors measured by high throughput microscopy | Microscopy/Imaging |
| 20140 | Cell signaling response to growth factors measured by ELISA | ELISA |