NRG1 - Protein (ID:)
Name: | NRG1 |
HMS LINCS ID: | 200853 |
UniProt ID: | Q02297 |
Alternative Names: | Pro-neuregulin-1; Pro-NRG1; Neuregulin-1; Acetylcholine receptor-inducing activity; ARIA; Breast cancer cell differentiation factor p45; Glial growth factor; Heregulin; HRG; Neu differentiation factor; Sensory and motor neuron-derived factor |
Provider: | PeproTech |
Provider Catalog ID: | 100-03 |
Amino Acid Sequence: | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE |
Gene Symbol: | |
Gene ID: | |
Protein Source: | E. coli |
Mutation: | |
Phosphlorylation State: | |
Domain: | |
Protein Description: | |
Protein Purity: | greater than 98% by SDS-PAGE gel and HPLC analyses (source: PeproTech) |
Protein Complex: | |
Isoform: | |
Protein Type: | |
Source Organism: | |
Reference: | |
Comments: | |
Date Publicly Available: | |
Most Recent Update: | 2017-05-02 |
Datasets:
HMS Dataset ID | Dataset Title | HMS Dataset Type |
---|---|---|
20138 | Cell signaling response to growth factors measured by high throughput microscopy | Microscopy/Imaging |
20140 | Cell signaling response to growth factors measured by ELISA | ELISA |