EPR - Protein (ID:)
| Name: | EPR |
| HMS LINCS ID: | 200851 |
| UniProt ID: | O14944 |
| Alternative Names: | Proepiregulin; Epiregulin |
| Provider: | PeproTech |
| Provider Catalog ID: | 100-04 |
| Amino Acid Sequence: | MVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL |
| Gene Symbol: | |
| Gene ID: | |
| Protein Source: | E. coli |
| Mutation: | |
| Phosphlorylation State: | |
| Domain: | |
| Protein Description: | |
| Protein Purity: | greater than 98% by SDS-PAGE gel and HPLC analyses (source: PeproTech) |
| Protein Complex: | |
| Isoform: | |
| Protein Type: | |
| Source Organism: | |
| Reference: | |
| Comments: | |
| Date Publicly Available: | |
| Most Recent Update: | 2017-05-02 |
Datasets:
| HMS Dataset ID | Dataset Title | HMS Dataset Type |
|---|---|---|
| 20138 | Cell signaling response to growth factors measured by high throughput microscopy | Microscopy/Imaging |
| 20140 | Cell signaling response to growth factors measured by ELISA | ELISA |